SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|101473 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|101473
Domain Number 1 Region: 5-168,199-318
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.72e-75
Family WD40-repeat 0.0000902
Further Details:      
 
Domain Number 2 Region: 242-314,341-510
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000216
Family SGL-like 0.09
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|101473
Domain Number - Region: 1000-1044,1084-1148
Classification Level Classification E-value
Superfamily TPR-like 0.0239
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|101473
Sequence length 1228
Sequence
MLTKFETKSARVKGLSFHPKRPWVLTSLHSGIIQLWDYRMCTLIDKFDEHEGPVRGISFH
SQQPLFVSGGDDYKIKVWNYKQRKCLFTLLGHLDYIRMTTFHHEYPWILSCSDDQTIRIW
NWQSRSCLSVLTGHSHYVMCCQFHPTEDMIVSASLDQTVRVWDISGLRKKNVAPGPSGIA
DQFRNPGTTELFGQTDAIVKHVLEGHDRGVNWVCFHPTLPLIVSGADDRQVKLWRMNESK
AWEVDTCRGHYNNVSCVLFHPRQELIISNSEDKSIRVWDMTKRTCLNTFRREHDRFWVLG
AHPTLNLFAAGHDSGMIIFKLERERPAFAVHQNILYYIKEKYLRKLDFNTSKDVAVMQLR
GSGKVPIYSMSYNPAENAILLTTRAANLENSTYDLYTIPKDSDSQNPDAPESKRSAGVAA
VWVARNRFAVLDRSHTVVVKNLKNEITKKIQVPSCDDIFYAGTGCLLLKDADGIVLYDVQ
QKRVLGSMKAPKVKHVFWSADMSHFATVSKHHIHICNKKLESLCTMHETVRVKSGAWDEN
GVFIYTTSNHIKYALTNGDYGIIRTLDLPIYITRIKGNSIYCLDRECRTRVLGIDSTEYK
FKLALINKKYDEVLHMVKNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFGLALECGNI
EIALEAAKTLNDKDCWDKLGEAALLLGNHQVVEMAYQRTKNFDKLCFLYLITGNLEKLRK
MMKIAEIRKDLSGQFQTALYLGDVQERVKILKNCGQRSLAYMTAATHGLTEETEQLSLTF
DPEKESLPDVDPRAHHLRPPAPIMQQETNWPLLTVAKGIFFDPTLTKEAVGGHIVYTGDE
DVGEAGPGWGEDDVVIDEDGYVLAKEDRHADEAGAGTSGAGGGWDVEDDDLELPAGLEIG
PIGGGMESGVYLPPTKGVSQSANWCNNSQLPVDHILAGSFETAMRLLHDQVGVVDFQAYK
EIFLQTFMRGRSYHLACPSLAPLTTHLHRNWKEAGAKAGVPAVGLKLNDLVQRLQSAYQL
TTQGKFADAIDKFRSILLSIPLLVVDKKQDISEAQQMLEICREYLVGLCMELERKELPKE
TLDDQKRNCELAAYFTHCNLQPVHMVLTLRTALNLMFKLKNYKMAASFARRLLDLGPKPE
VAQQTRKILAACEKTPTDAHELKYDEHNPFDICAASYVPIYRGKPVVKCPLSGACYLPQF
KGQICRVTKVTGIGKDTIGLRISPIQFR
Download sequence
Identical sequences T1ED49
XP_009022210.1.102002 jgi|Helro1|101473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]