SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|101510 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|101510
Domain Number 1 Region: 130-348
Classification Level Classification E-value
Superfamily vWA-like 1.72e-55
Family Trunk domain of Sec23/24 0.0000687
Further Details:      
 
Domain Number 2 Region: 3-45,369-462
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.05e-46
Family beta-sandwich domain of Sec23/24 0.00064
Further Details:      
 
Domain Number 3 Region: 465-569
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 6.54e-26
Family Helical domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 4 Region: 570-719
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 3.14e-25
Family C-terminal, gelsolin-like domain of Sec23/24 0.00041
Further Details:      
 
Domain Number 5 Region: 43-125
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 3.92e-19
Family Zn-finger domain of Sec23/24 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|101510
Sequence length 721
Sequence
MSDNLVCDPEVMCCTLNVLPNTPALLQKARLPLAVHVQPLKDIPNVPVVKVDTIVRCRLC
RMYINPYVVIIDRHRWKCCMCSRFNDLPEDFSYDVKRKAYTNGRHRNEMNSSSYEVIASP
EYIVGNLAVPVYFFLLDVSYNAIETGYLISLCQSVIEKLESLKTHDNVMVGVMTFHTSVH
LYNIHHRYTKPIVYKLPDLENLFIPAPDGLLVNLKTSQSLFVDLLTNLPSMHKDNKEIGS
CLGPALKLAYEILAPTGGRVSIFQTKIPDVGEGSLKSREDPNKRAGEVVQNLTAATDFYK
KVALDGSSSHVAFDLFMLNTQYADLATLSVLSRYSGGCLFYFPNYHLTSNPVESSRFDET
LDRYFSTNVGFEAVLRVRCTQGLSLQLFHGNGFVRSVDLLSLSSVTPDLSYAVQIQMEDS
IEDTKVCIQAALLYTTNRFERRIRVHTICLPVSTYLSDVFAHANQMAITALVAKMAVDRS
LNSSVADAREALTNVALDALNAYGENLSSGQRGGQLPCPFFLRALPLYILGLLKSIPFRL
GVSTKLDDRVFMLDQFKTLPWTHIIKYIHPNFYPLHKLNDRNALYVDDRVICQPPLLPLS
AGCMDRLGIYLLDDGFNMYLWLSSSVSRAFLRDVIGVQKFGDVLSGLFEFPHLDNVWSEN
VRNFIEYLQSTRSTYSPVILIRDDQTDRVMFYERLLEDRTSDVLNMSYIEFIRHLHSLVT
Y
Download sequence
Identical sequences T1ED51
jgi|Helro1|101510 XP_009022295.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]