SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|103882 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|103882
Domain Number 1 Region: 441-588,668-799
Classification Level Classification E-value
Superfamily L domain-like 1.86e-52
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 3-134,218-359
Classification Level Classification E-value
Superfamily L domain-like 1.26e-39
Family Ngr ectodomain-like 0.0018
Further Details:      
 
Domain Number 3 Region: 1072-1113,1148-1300
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.15e-30
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 4 Region: 897-1025
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000753
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 5 Region: 839-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family EGF-type module 0.0087
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|103882
Domain Number - Region: 1371-1408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000269
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|103882
Sequence length 1432
Sequence
MDNQIMTVEKKSFDSLVSLEKMRLNRNKLTTLPENIFSRTTNLQKLDLSNNMLRAIPKKL
LRGVQVLKHLNLDNNAISCIGHNAFKHLKTLEVLTLNRNNLTTLNEESISQLHSLKIIRL
GDNEWRCDCRLTWMSEWLRSHVSTALLTRCHHPQHLKNVQVIDLQPSDFYCDGSEDHAMD
CSKQPPTCPEVCSCTNNVTHCQERGLRGLPQNLGGDNIMELHLEQNVITEIPSKAFIALK
NVIRLDFSKNSIVKLMSDSFEGLNSLTSLLLNDNKISNLPVGVFNGLKSLQLLLLNGNKL
KCLRGDTFSRLANLNLLHTRTHTHTHVQVARRDKQTNKQKKNRHLGRNPFVCDCSMKWLF
LYLHLHPIETSRAKCFGPKNMRKKVISKINKDHLHCPGCGDDDDDANEECVPDDECPAEC
TCHHGHQHGAAAAAGGGGGVQVDCSAKKLKVVPWKIPTSTEELKLSDNLIETVKVGWFNK
LKNLKKLDLCNNKILFIEEEAFEGLNQLEELQLNDNSISSLSPTTFKGLKNLKTLMLRSN
RLNCINNQTYRPLVSLQHLSFYGNQIRCIEEGSFDYFNNFITINLQSNELNCNCHISWFR
DWLVKNNNKRVQLEVPSCFYPVRFKGFLLSQLKPGDFKCEDDNICDRRMICPEPCKCHGG
EVRCSRANLSSFPENLPTDVTELYMDVNSISELPRDMNDLKKLTSLDLSNNKFVSLPENA
FANLTNLNTLILSYNKLQCVQETTFSKLHNLRVLSLHGNDLSSIPYGSFKDLLSLTHLAL
GGNPLYCDCNLKWLSDWIKEGYKEPGIASCVGPDDMANKLLLTTPSSKFQCYENADNSVL
AKCNACYSEPCLNGGTCQPEKIHQFKCTCLPGYHGELCSGVVDACFGDPCSNGGRCICLA
GFEGEWCELNVDDCQRHSCLNDATCIDGVLGYTCRCLPGYSGDYCERKIEHCTESNPCMN
GGKCLPIHAGSSYKCQCEPGYTGLNCSEDIDDCLFHICQNGATCEDAVNSYKCTCSPGHQ
GRYCEVAYIAMRDQLMQGACKQHDCKNAGLCLPQQPQQQQLSSNNNNNMEYICKCANGFE
GKKCEKLTSLTFIGDAESFVALPPSILLPFPPHHHLHHHHQQQQTQQHHHNNQHHQHHHE
QLRPTSNNITLQLSTVSSSGILLYQGQGDVHMVVEIFMGRVRVGWNVGNNPTSTMFSYET
ISDGKLHQLEIVTHGKNLTMLVDGGAGKTIMNEGSMNELKLENELIYVGGVVSGLKEELM
KRWQIRRTDSFTGCLKKMIVNNRPIDFSLVHSQLKIQPGCFETASPASPSTRLDGPSNSR
DHQYDSLHDSLHHNKNNKINYSQLNFKKHNNINNKNNNNKSKYNINNIYNDACFNVSCKH
GRCSALDAGRFQCICQQGFSGLLCDEVDLDPIKDGSRDEDALMPPPTNVPRF
Download sequence
Identical sequences T1EDI1
XP_009029682.1.102002 jgi|Helro1|103882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]