SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|104323 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|104323
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000394
Family Integrin A (or I) domain 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|104323
Domain Number - Region: 339-438
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 0.0235
Family NIF3 (NGG1p interacting factor 3)-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|104323
Sequence length 501
Sequence
MPTVILLDASLSMVRTIADKEKFDPTTSTNNHVVNRKQLAIAGICALLDHLSSNYKLEFV
SLVTFSHTFNQLVPFTRDYNEIKSALSTYEDQNITDIEVGLEGAARVILNEWGVTPTSQV
LLITEGRLGLSEHCLPSYLKRLKNPTKKLLFPFPFKCVLHVVCLSTITSHENFTEMISSY
EQLLMLNNGAIKMYTPDKFLNVSAVKSLFKELAEENFKPHPCYLKCGNLRCHISVFPDFH
KKTLDYYTFKFLNAISTSIWPELEICGFMNISDVASPPFLSKHLIFPALDPESSEDKEGA
EKVPAFTVLLHGSLKVENMVAIVQISEAWFGMLYSHADSKKKSNLTLACFHTGLDALPWL
GNFKKLGPMKEGEPSPYLDGKSPFPVPTSDCKSYSQNCVVWIHNAGLQGDIQKILRNARK
LPEKQTQFYKEMNRLKKAVLAIGFYELFESLASLLDRERSLLPSHTHPSVGIQISYASKV
LRSPQILDINQAIIPPQINLL
Download sequence
Identical sequences T1EDL0
XP_009030999.1.102002 jgi|Helro1|104323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]