SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|105252 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|105252
Domain Number - Region: 11-179
Classification Level Classification E-value
Superfamily vWA-like 0.0156
Family Integrin A (or I) domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|105252
Sequence length 741
Sequence
MVLLDNQKVYDVAIVVEATSGAADYYETMRTSYLLPILEFFNGHSIDEPVYGYCCNSSLY
SLITYKGNDHPFSNMSTCSSPTYNCHEFAQTLNQISFSGGMLDPHSFIAEGLATALSLFE
DIDLIRKNRVKAEKHLILYCSNGPYQFPCLGHYKYLNKTTEQLVNLLAESNIHFSIISTR
KIHSLVKLFELGQPDPSCLTKNYASDSTHLVLLNDINITECPLSPSAKSSDESNMAVKPA
TTIPAPKSVCISIVRPQQGMSQNISANKEAVETFSIRPVANLSAVPQQQQQMSVQAPNSV
APVHPLTFTGSPATPTAIALRRAAVNQQQQQQQATMQVGGYQASLDPQSQLMQQQQMQQQ
QMQQQQMQQQQMQQIQQMPQNHLQQQQSDSLLQQQQQQQQQQQQQQTQSNNLTNVDINNP
GPTLALAAQQQQQQQQQIQQQQRIIWTGPLEWTDKLKNQSVKITRTLPCQININQDEPEI
NTSKWPEKLTMSIFPPSVIQPLQHLFRSSRTVLFNFNQNSDTEAMNSLYRSLSNNFSGCI
HFSTTPETSNDIKVLMLLYSNRKQQFLGLIPYDQANFLKSIKSVIAKHKVMKPQNPGEMV
GTSAQSINQPTLQHQQITYQQNMQDPRQQHMLAIQQQQQLQQQQLQQQQLQQQQQMQQQH
LQQQQMQQQQQMQQQRMQQMPQMHIQSNSQPLRYLLLNQQRPQHHMMNRPRGPATTLQQQ
QQPGVQTFTTMATDDFPPFDL
Download sequence
Identical sequences T1EDS3
jgi|Helro1|105252 XP_009008966.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]