SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|105364 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|105364
Domain Number 1 Region: 243-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 2 Region: 152-286
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000293
Family Growth factor receptor domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|105364
Sequence length 314
Sequence
MIHINTPHREDAYWILPSKYYTYPLSLYKGALRYTASYYSSYPFHYGKPDVILRVEDTSQ
FLYYTYPDNTFPVDTPKEFVIPLYEAGWVDAQNNPVSRDTFMGVLKSLQSIWVRAKFSTG
VDVEDRLSAVSVEYSVRDYEVELGQNGYPILEKCHCLPGYQGQWCEDCQPGYRKTVDDMH
YVHCEQLDNIQCDPRTGHCQGCPHNTVGRNCECPHGFYMDRANNCEPCLCPVDASIDGRE
KVSCSLSSVGTLVCHNCPVGSTGSRCERCLFDYEGDPSIFGGRCVPTSDVPRPPVIETSD
GDQKIDDKSFGDTM
Download sequence
Identical sequences T1EDU0
XP_009009178.1.102002 jgi|Helro1|105364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]