SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|105994 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|105994
Domain Number 1 Region: 235-397
Classification Level Classification E-value
Superfamily vWA-like 2.62e-39
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Domain Number 2 Region: 13-234
Classification Level Classification E-value
Superfamily vWA-like 3.09e-39
Family Integrin A (or I) domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|105994
Sequence length 402
Sequence
MLKIFSKFILAINIVICFTSCSIAGPQPSKCVSRNAEILFLIDSSSSVVENDPPGNNGNS
WSYVKSFLSEVIQLLPIDKGETKVGVITFSTKVNTNNNTVLFSKTKSVLNVIANLPYSGG
NTNTSGALRYARSVLLNVTTLQGTVPSSTSSSYDVKKVIVLITDGLSNVDSSLTLQEARL
NKQLSIEQYAIGITKYMNEDELQDLVSDPVSYHYLNASDFSHLNLLINELLQRLTCSQPP
LPEPCRDTRSDIAFVLDSSGSIIIQHSDNSRDLSNWVLVKNFVINVAKNLNIGLSQTRIS
LITFSHIARVEFYLKDFNDFESLAANISKIDIIGSETNTSGALRLMNDVVFNVKNGDRPD
VPNVAIVMTDGQSNVNQSETIPEAIRAKNFGIINFKIIFLRI
Download sequence
Identical sequences T1EDZ1
jgi|Helro1|105994 XP_009015471.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]