SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|106317 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|106317
Domain Number 1 Region: 158-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000354
Family EGF-type module 0.019
Further Details:      
 
Domain Number 2 Region: 56-201
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000785
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 5-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family EGF-type module 0.0069
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|106317
Domain Number - Region: 198-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000137
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|106317
Sequence length 265
Sequence
MGYEVHDGVCIDIDECNQTSPCDSTSSNCINMNGTYECVCKDGYQKDKSTGICLACQDGM
YGKNCSKLCQCSPAMCNKTTGCQSPCENSGFTGADCDENVNECQINGICGAANCNDTHGS
YYCYCPQWFQLMGSNTNIKCSVIDACQYNVTDGGTQLVNGTCVNNGVCKNGTNLAAPGTF
ACECAPGFDGKFCEHDIDECLSNNCDLKTQHCVDQINGFYCACNPGVSGPGCNFFGTVVF
YLVVIFHLIVTSLYFLGTVFTSRCR
Download sequence
Identical sequences T1EE19
jgi|Helro1|106317 XP_009016092.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]