SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|106435 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|106435
Domain Number 1 Region: 289-453,493-620
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.71e-57
Family Tandem AAA-ATPase domain 0.00066
Further Details:      
 
Domain Number 2 Region: 56-249
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-30
Family SPRY domain 0.013
Further Details:      
 
Domain Number 3 Region: 2-68
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000112
Family Tandem AAA-ATPase domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|106435
Sequence length 738
Sequence
MTAFEEMGVMSELAQAVEEMDWNLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFCLPV
IQIVCETIKDIQEGKTKKSQGNKPAAIPTKWKMNVFDRTPAMAIDTEEGLVCQSRDFQGW
HGTRSNKGVSIKGKYFYEATVTDEGLCRVGWSTMNAFLDLGTDREGFGYGGTGKKSFGKQ
FDSYGESFGLSDVIGCYLDLDNFTIKWSKNGVDFGKAYDIPPNLRHSVFYAAVCLKNAEM
KFNFGGSRFSHLPKEGFVSLMDAPRDCVVNSTASGGSKEGSVAAKPNAPYAIIIEPSREL
AEQTFNQIKHFKKKLSTELRELLVVGGASAKDQIDALMKGVDIVVGTPGRLEDLISTERL
LLSSCKFFILDECDGLLSAGYGDLISRMHKQIPQVSADGKRLQMIVCSATLHSIDVKRLA
DKLMHFPTWIDLKGQDSVPETVHHVVLMVDPKTDTTWKTLKNHIKTDEVHSKDALNPSIE
TPEMLSEAVKLLKGEYVVRAIQQQKMDRAIIFCRTKVDCDNMEEYLIKSGGGKGRNSQFS
CVCLHGDRKPNERRDNLEMFKRGDVKFLICTDVAARGLDVSGLPYVINVTLPDEKQNYVH
RIGRVGRAERMGLAISLVSVVKEKVWYHSNCSSRGKGCYNTRLTDEGGCCIWYNEPQFLS
DIEEHLGVTIDQTDTSLKIECSEFDGKVTYGQKKSVTGSEYKGHTEILAPSVKKLAELEK
KSQSSYINLLYMKPFLSR
Download sequence
Identical sequences T1EE26
XP_009019468.1.102002 jgi|Helro1|106435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]