SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|107164 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|107164
Domain Number 1 Region: 916-968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.0016
Further Details:      
 
Domain Number 2 Region: 716-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 3 Region: 764-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 810-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000223
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 5 Region: 407-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 6 Region: 868-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 7 Region: 284-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family Laminin-type module 0.061
Further Details:      
 
Domain Number 8 Region: 220-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 9 Region: 1068-1115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000131
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 10 Region: 968-1015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 11 Region: 459-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 12 Region: 1020-1061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 13 Region: 1424-1547
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00000641
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 
Domain Number 14 Region: 347-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.023
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|107164
Domain Number - Region: 1570-1709
Classification Level Classification E-value
Superfamily Tropomyosin 0.015
Family Tropomyosin 0.015
Further Details:      
 
Domain Number - Region: 63-126
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0999
Family beta-mannanase CBM 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|107164
Sequence length 1731
Sequence
MIGRQHRLSASSTCGLQKVETYCIFSGLDRTVNRNKCFLCDSRNPNNPRSHRVENIISRY
RKDWESRWWQSENGVHNVSLQLDLEAEFHFTFLTAKFKSIRPAGMVIERSYDFGKTWKVY
KYFSTNCTRLFPNMTIGQRSHHCDEKQTKMFPSSKGEIYFAPIQNSSLKIYSKEMQNLLK
VTNLRINFTKLHSLDDQFLTTQSNIKHFYAVYQLTIQGRCSCYGHADTCSGVPGEKNNID
GKVHAKCECAHFTTGHNCEQCMDFYNNLPWRPATKDNSNACQKCNCNMHSMKCHFDPVVY
VISNLTSGGICDDCQHNTQGYNCEQCKPFFYHDPGRPITDPYACQSCNCDPRGSLYKGEC
EPKNNFVLDLAAGHCHCKENVEGTRCDTCKQGFAKLSDDHPLGCEACDCHPIGTSIEEGT
CNQFTGECKCKRFVTGKQCDKCRPGYWNFGKQPQGCTPCDCDIGGAADWNCNQMDGGCTC
RPNIIGRYCNEVPSKYFVPGLDYLIYEGEFADGIGRYEVENREIYEGGYKSWTGTGFMRV
YEGSSIDFHVKGIPYSTHYDVIVRYETPDQGTWHDVTLYVMRSEPTKLGTHCGNVIHTDQ
NAPVEISDRFRHYILIHSTCLEQGSEHKIRINFNKFSPYETSPDKFVLVDSIVLVPSADQ
HPTMQFTELNNIRNDYERYGCINHYLSPAYQWELPAACRKLIFSASAYIHDGAQACDCDP
VGSEDPECDAIGGQCRCKPNVVGRRCDQCEYAHYGFGPNGCSRCKCNMIGSLDNNCNVTT
GQCKCIQNAYGLRCSECQRGFFGYPHCRPCQCNGMSDDCDGETGQCLACRDNTGGHNCER
CADGYYGDPRTGGCKPCMCPGGAGSGAQHARTCHQDPSTGTVICHCDEGYSGYQCDRCTQ
NYFGDPLISGGTCQQCLCNGNIDLSVPDSCDSTTGECLKCLYNTIGYSCNRCRQGYYGDA
VQKTCKPCECSALGTNKTLANDCDHVTGQCHCLPNVVARKCDQCEINHWRLYGGDGCIPC
DCDPTGSLMEQCDVFQGQCPCKTGRGGRDCSECPAYHWGSPAIGCKPCSCNPDGSTSRQC
DKLTGQCKCQKGVTGLKCDRCDRGTTGQLPHCQPCGECFDNYDVLIHDLEGAVIDVNKQV
YDMRLSEKNKAYRAEFNDIEDDLNDLDYLVHHLNASHTEKFIAECVDEEFKNKTKEMEKM
LIAKSGDNEAHDHQFQTLVEKFVQVNQTFEKVKHDNNDLLGEVKFFEENAIYEQEQNVEG
AHKSILESMNSVEVMEAKVPSLKNQISWYAGEVQKKNEGLDHFDDQKKADAEDGNDDYDD
AAEVDHMAAMEKEINKIKDQILDLNFETCGGQGKTCDDKCGGANCKTCGDDNDHTCTDGS
VTKSVVAFKSFKESEGVLGQLVKQANSLTLNLSQISKNCTKSEQEVKKLAERSKQARSDS
ESNLSNITSLQNEAKEFMEKEKELSDDIKKVYNDTMSVSLEIYEPRLKELSEQIKTAAQS
LEDVRQITVDTKQDQEASSRAAVEASRVLNDSRRLHGDLEKGLKDMNDLMGVDDLTAMVE
TLTNDSMKFKEDVNALFDKMRELRAKSSNSTPRVYNINARLDKVKKSIADRDSLIKLLND
KRLRIEKKKVEVKKRLDAYNELNDQLTEKWKLYDQNFEINKSSTKNLLNRTDEIKKNVFS
SRQALEVARVHFDEFQMTAKEHNKLIKTLLERIHIIRDEIQTKSKIHFLCR
Download sequence
Identical sequences T1EE82
XP_009023017.1.102002 jgi|Helro1|107164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]