SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|108375 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|108375
Domain Number 1 Region: 14-44
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000156
Family G proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|108375
Sequence length 51
Sequence
MSTKSGEYGNPLQKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQVVGVVCG
Download sequence
Identical sequences T1EEI6
jgi|Helro1|108375 XP_009030392.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]