SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|108977 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|108977
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.15e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|108977
Domain Number - Region: 365-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family Laminin-type module 0.045
Further Details:      
 
Domain Number - Region: 330-460
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00643
Family Growth factor receptor domain 0.0035
Further Details:      
 
Domain Number - Region: 703-830
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00942
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number - Region: 543-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 847-876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.023
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|108977
Sequence length 964
Sequence
MHACHNTFGSYLCSCFTGFRLQHDGHRCYDVDECRAWSNPCQQLCTNTHGSFVCSCKSGF
HLNSDRKTCTDINECDDDDKLTKCQHYCVNTFGSYHCLCAHGYALHSDGKTCLGWSVCVC
VNHKNVALVTSATTLATTSEPMQQIETFTGKFSLIENEQNFHLKPDPTTVHFNVQLKGRF
GPDCQFSCLSSCENGARCNGQLNACLCTPGWFGILCQYPCPQNFYGSDCQYMCGCVNGGK
CNSVDGSCTCPPNRRGERCQHGCPSGYYGPHCKQKCPYQCKSGSCNEVTGHCECGPGRKG
VTCADECESGYWGTDCAYFCKCHAEQSRGCHSLTGTCICNRGYTGDTCELKCPDGFYGYG
CYERCSCGKDGGVGGHCDHVNGSCFCPPGYRGEMCDEACPPNKYGHSCSETCECVVNQSK
SCSLRDGFCQCKPGFKGKHCEDKCSKGFFGEGCNYFCQCYNGATCDHVTGDCSCPPGWWG
DGCREVCPAGMWGKNCGERCTCSQPSQCDAVSGRCLCAIGWTGARCHQKCPPNKFGVNCS
TPCNCNERGTLRCHPETGTCECSDGFIGVNCEKICPGGYYGEACKQKCTCANNSTCHAAS
GKCRCKSGWLGDDCDKPCGVGFFGPKCSRPCRCGSDEECDHVNGDCYCRDGFSGQRCTRD
CPEKTFGPKCEFECWCHPSSVCHPYFGSCRCPPGFLGPHCNETCPVGYHGDNCTKICDCL
NGATCDHVSGMCSCRDGWIGSKCEQACSEGFYGHKCQNACLCQSQSKCDHVTGRCTCGMG
RTGEMCQEECVNGTFGPDCSQRCQCLNGASCNAVSGVCVCPAGWYGPRCQFVCPNGWFGS
HCEHKCSCAHASKCHPITGECLCASGYHGERCEIAEMSEEMKKKRKKMMTMIEKKKCETG
FYGPQCSSRCSCSNESTCDHVTGKCRCTSNWIGPTCSNDAGKADNERSDVPVERSDVPPE
RGRS
Download sequence
Identical sequences T1EEP5
XP_009010813.1.102002 jgi|Helro1|108977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]