SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|109220 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|109220
Domain Number 1 Region: 229-437
Classification Level Classification E-value
Superfamily vWA-like 9.64e-28
Family Integrin A (or I) domain 0.004
Further Details:      
 
Domain Number 2 Region: 455-625
Classification Level Classification E-value
Superfamily vWA-like 5.98e-23
Family Integrin A (or I) domain 0.0067
Further Details:      
 
Domain Number 3 Region: 686-734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000545
Family EGF-type module 0.0093
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|109220
Domain Number - Region: 727-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000144
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|109220
Sequence length 911
Sequence
MGPPGVQGLNGFNGPPGLPGSQGRTGATGRTGATGPQGPFGQQGPLGPSGSQGPRGPDGP
RGNDGPAGTPGPQGRTGAIGFPGATGTFGFPGRIGDTGFSGFTGDTGRDGAVGLQGDSFT
GAPGNDGRPGAQGIQGTQGFQGQPGSVGFPGSKGFTGGTGLRGASGSPGQNVFGPVGPPG
MMGPTGSTGPPGQPGAPGPLGPAGSAGSSAAASTSGTCKPVNECWVDNRLCSQLCVDTFD
SYYCSCYDGYQLETTTNSCPNSLQCQSVSADLVFVVDNSFFVCMSASTCQSYRDVLSFIN
SLINTLSSNTRVGMVLYSSTSTNYFYLNSHNSIQQVQTAITSATYDGSTGSNLSTGLREM
RLTQFDPTRDRTAVDNVAIILANGIDNNAASEAALAMEAGIILIPIGITSRVSRTQLASL
ASPPFGQTPSYFVSDAGNSFNSQLQTVSLRVCQSASQSQCQGMVMDLVFLIDIQPPSSAT
WDQLKTSLVQIVQTLDVGQSAVRIGIVTFSSAAVVTQYYLNQFFSRDAAINAINQLSANV
QGTSSSNWLSAFQALRTSQFTSNNGDRTDVPNVAILFAFNPSTVQSLGLLDEAGRLSKAN
IKLYAYGWTVSGMDSSLTYISSYPHLKTEQWALMDDTKIKYFPSTLTTDLCRPVLQASCR
KTEYGGYQCFCPLDTCDIIPLNGTKCVDINECATNNGGCQQLCSNSIGSFACSCQSGFRL
ASDKMNCEDINECLQPNVCTSGYCVNSYGSFYCLKYNANPPPQNLASMLNPADSNNNNMT
SLSASKEEPITSSTLVIVGALSALFSVVYVTLCTIIFFVIVSKCEEDDDNDILDDCDMRK
SSNNIFSLGAGSLKGSEFGSVKSKFGFFDQDQFGNKVVARTKREKVSGSAFTNDDGVVGS
TNSNEVRASEA
Download sequence
Identical sequences T1EER5
XP_009011204.1.102002 jgi|Helro1|109220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]