SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|109631 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|109631
Domain Number 1 Region: 327-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000399
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 2 Region: 440-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000164
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 3 Region: 287-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000675
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 403-444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000163
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 239-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000224
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 6 Region: 364-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000547
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|109631
Domain Number - Region: 123-194
Classification Level Classification E-value
Superfamily Cupredoxins 0.0146
Family Plastocyanin/azurin-like 0.0098
Further Details:      
 
Domain Number - Region: 205-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0935
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|109631
Sequence length 605
Sequence
MLFLLLLSLLSNNNSNNNNKHFYTPSNFLISNKCKLNMYCKFLVTFVLTVVACSSAVASE
QLNCSVGQPFSLKIKKVNVPQKDAVVWDVLTICHDTKSCYGPEFNVQLDMLPQVIPFFTQ
FNNNLISFTSPSSGMTYYRTDENGFKFCNFDRQNIVPNINNVPVSLGRNYFIASSSTSPW
LSCQGGQRLNVTVLADDCKFQPASLTFCNGMGLCAARTWEEMFTCKCCRPNYGQYCEMVD
GCHWYKDDCENGGWCVDELNDQMDKTLYNCKCPHGYSGSRCEQQDNPQCSRNECKNGGTC
LVTEANVYGFMCHCPDGYQGVTCEVQVDNCASNPCFNNGLCVNGVGTFTCICADGFAGSY
CQSDLRVCRADTCQHGGTCQVVNGTATCACPIEYTGVMCSESRNLCSPSPCKHALECSFN
SRTYTCICIVGYTGRDCEINIDDCASNPCGSQGTCVDGVASYRCHCLGDTVGSSCPEPAD
VNQTAQSSKETNANELNNTSSSSNNPALSVLGIIFIILVSLAIIICLIGGGWYLMRKRRR
RQYVEQINDTNSMSMKDRINTTSAFPGELFGDDTYPESIPDVSFSSSSSVSDTPLVQRRK
KASKI
Download sequence
Identical sequences T1EEV3
XP_009012455.1.102002 jgi|Helro1|109631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]