SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|109730 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|109730
Domain Number 1 Region: 261-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000913
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 2 Region: 224-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000189
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 3 Region: 402-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.027
Further Details:      
 
Domain Number 4 Region: 301-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000447
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|109730
Domain Number - Region: 334-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000811
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 89-129
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0118
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.019
Further Details:      
 
Domain Number - Region: 371-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|109730
Sequence length 623
Sequence
MNSLLKISCVILILVAAAVEKLEAGGNLEWTILKYVNPGGKISNGQICEWYGPCDHVFTF
GLDDVNGDDNPLTTPLLTKKTSAFNNEDTNTFTSGADNHGVFNPIIYPFTFWKGGIRLKV
SVVDDDSVFGFSPDYVDGLVYKLVAKPSASYLSAVSVSTVMGIRTKLYFTYRVYCDANYY
GDDCAKNCVGHDDSLNGHYSCDSFGNKVCLKGWENEGNNCKDRQNDCETNNCQNGALCID
GIRSYTCQCKPGYTDKYCDTNINECLSGPCQNGGACIDGVNDYTCMCQQPYVGKNCAKTA
CTVSSPCKNGGSCYGDSKCLCPSNFVGDFCEIPLCNKTGCLNGGKCSLDGSCMCPPGVRG
FTCDVVLCDFTGGFCLNGGICTNGRCECPNEFAGATCGENIVCKYTRCQNEGQCRSVVTN
TSTSYEPKCFCPSGFSGAYCEIVPQLDVVKYNNTLSYVSVPDELNKRPFTPLEILFIFFI
VMTFVLFIICIVLSVLLCKARKSLSRNNKKKVLKSVTSVTSDCSSTSDVFSEPGRSTVNS
STTSSHNDTFKTSENFSISNTVTSSVLPNIYSSTLEDRAQVNKIFDDCTYSRLNDEEIGF
GECLKKGVVENEVNSDSAQILDA
Download sequence
Identical sequences T1EEW1
jgi|Helro1|109730 XP_009012630.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]