SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|110109 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|110109
Domain Number 1 Region: 80-341
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-87
Family Eukaryotic proteases 0.0000824
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000183
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|110109
Sequence length 345
Sequence
MKLTFQVMDIESSPLCGYDSVSVWDVVNEKGVPLGKFCGKTLPVETLKSTGRFLFVYFIT
DKSKGDGKFAIQYESVNPKPPEPSDDMCGKPAIQPSTRIVNGYQAVPHSWPWQVSIRLVI
GSKQYHICGGSVISSSVIATAAHCFFDEKHKPHDFRSLKVVVGDHDQKTNLDGKTQSPAI
QKVIYHQSYNPNSASSPYDIAVMLLQTPLTFDSSVSPICLPREDVSVNSLCFATGWGDTN
ETGDETVLNQVRLPIVSYTFCSQREYYGSQIIATMLCAGYDEGGKDACQGDSGGPLACYN
NINKRWYLQGITSWGAGCAKPKRPGIYTRVTKYLGWIYQNSGVIS
Download sequence
Identical sequences T1EEZ1
jgi|Helro1|110109 XP_009013469.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]