SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|110309 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|110309
Domain Number 1 Region: 331-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000119
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|110309
Sequence length 489
Sequence
MGPPGERGYTGYTGISGRQGEPGSIGPQGNTGSTGLPGPPGSKGDKGLRGDTGRDGKPGV
TGATGEIGLPGKDGLDGLQGEPGRDGEKGETGDPGPQGFQGDSGSPGLHGFTGHTGSTGV
AGRPGVQGPKGDPGFKGITGATGYTGDIGNTGNTGPRGATGFAGKTGFTGNTGPAGLPGK
TGESLRATGVVGPIGPPGSRGMDGLNGLDGRDGEQGQPGEAGQPGLQGDTGLTGPRGNPG
PTGLKGDTGWTGVRGRDGTPGEPGRDGQVGYTGFTGPVGPAGAPGLQGPRGFSGNDSNLI
VIANCPCRKGELCVTHLGDPYPYCLPIVPNCRIDNGFCDHGCTMDANDRVQCTCRHGFEL
LPDSRSCGDVDECAGGLHKCSCASKCVNTMGSYICWESTIRDIHPLPPPITSGCGKNKRD
IDSKTVAQVTSENTFLVVVAVLISYLAIIVVVAWIFVHKSNNESNFTRVARIVDGMREEL
ESIRSVSRL
Download sequence
Identical sequences T1EF12
XP_009013854.1.102002 jgi|Helro1|110309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]