SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|110688 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|110688
Domain Number 1 Region: 2-140
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-20
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 2 Region: 207-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000709
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|110688
Sequence length 437
Sequence
MLFKTRKSNGVLFMAKSFTGYERYLLRVRAGMLSFTYDLGSDDRDLTLSNIKVDDGVWHF
VRIDRYGNVVELRLDSGDGMRYNSSTPASEHRYLKMSTANVLGDLSYNQYSKQTAVLDNL
EKTCISDVRYSGHLLPLSNEENTESLVTMTMVGGSDVGCSITGVCVDGLNCPTDQICVDL
WMKSECRCKQFWVANDPSHQNSICVAKSCSDSPCMNGGTCVMLDGKVACICSAEWGGLYC
TDNGPKEEETKNNTERNFNLVAAIVVPIIVGLLLLLLLLFLIYWCCCRRKEDRLLYGEPD
KEIRENVIAYDDEGAGEQDNYAFDLGKLQKSSTPLEVDTLKKTPNLETLPAYTTRGGDYP
SIADFISDRLNTVDGDPDNTGDDSKVNFEFEGQGSDAGSLSSLASSEADRDIDFDWLERA
GPHFARLADLYGDGGQV
Download sequence
Identical sequences T1EF43
jgi|Helro1|110688 XP_009014576.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]