SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|110878 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|110878
Domain Number 1 Region: 37-249
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-60
Family Calnexin/calreticulin 0.000000589
Further Details:      
 
Domain Number 2 Region: 248-387
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 4.55e-50
Family P-domain of calnexin/calreticulin 0.0000016
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|110878
Domain Number - Region: 392-434
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00554
Family Calnexin/calreticulin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|110878
Sequence length 556
Sequence
MKFCNNFLLILKLQTFFSLVSSHDDDFGGEVYVPPYTPPIPPPNSYFVETFQSEEEFNKN
WIKSSAKKEHTDDEISLYDGEWKLEEPVDAVIKKDVGLVLKSKAKHHAISSKLRQPFIFD
GQTFVVQFEAKFQRGLDCGGAYIKLLNHSDDLNLEDFTDRTPYVIMFGPDKCGNDVKLHF
IFRHKNPLTGKYEEKHGPKAPAVSLYEAYRDKLTHLYTLVIHSNNSFYTMIDDVVVTSGS
LLHDVNPPVNPSEEIVDVNDVKPQDWDDRLKVPDANAVKPESWDETAPEMIPDPNAKLPD
GWLVEEEEWIPDDRAIKPKDWDDELDGTWEPPLILNPVCETALGCGPWTPPLINNPKFKG
PWSAPLINNPNYQGPWLPRKILNPKYFYDPLPYNMSSIGAVGLELWSMQPDILFDNFIIA
SSVRDVRAWSLQTWKHKHDLEFSKVKKDKLSVVEAIITAANESPWLWVVIIFVIAFITLI
FIIFCCQPPQRADSDVIKKNKRKMNDLKRSSPSSSSSAHSNVTSSSKFSRDNLLSGDGQV
WMRTAAASASTFHQRK
Download sequence
Identical sequences T1EF60
jgi|Helro1|110878 XP_009014900.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]