SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|111195 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|111195
Domain Number 1 Region: 483-599
Classification Level Classification E-value
Superfamily TIMP-like 3.77e-29
Family Netrin-like domain (NTR/C345C module) 0.025
Further Details:      
 
Domain Number 2 Region: 276-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000774
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 3 Region: 345-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000193
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 4 Region: 408-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 90-166
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000051
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|111195
Sequence length 605
Sequence
MRLLSQPSNIFSQAEHIGIFSNQDMENIDPCYDEGRAIKCTADFVNVAFERPIVATSTCG
ESNRMSRHCQPLSNKQGQVTSKSCFLCDKSSSRRQHPPSYLTDLNNSNNLTCWVSENNVQ
YPKNVSLTLHIGKKFEITYVSLQFCSMRPESMAVYKSVDNGKTWIPFQFYSTHCQQMYNK
QPKAIISKANEQEALCTDPFVGTSDSNSAGSGSRLAFVALEGRPSAHYFDNSPVLQDWVT
ATDIRVTFNRLAIAQDEAFKESHYYSLSDFAVGGRCKCNGHASRCFVQGESLLLHSGLDK
EASSKLVCECRHNTAGNDCEKCKPFYSDRPWARATDRGAHECIACNCNQHSRHCRFNKKL
YLLSGRKSGGTCVRCRHNTAGRHCHYCAEGYFRDLNKPITHPTACLACECHSIGALGQSC
NQTTGQCQCKKGVIGLKCDRCGKGFQQSKSPIAPCIKIARFQDSRRSTRRRDGDNDDADM
NRCGNCNKRLKKFTTKQFCKKDFAIHTRVTSREIIGDWAKFTVQIYNVFKVSRDRLRRGP
ETVWVSVKDLNCKCPKLRVSRNYLVVARDSSSSRGGIILDKSSLVVGWSERLSERVRRVT
MSHKC
Download sequence
Identical sequences T1EF94
XP_009016507.1.102002 jgi|Helro1|111195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]