SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|111386 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|111386
Domain Number 1 Region: 497-743
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.83e-28
Family SGL-like 0.045
Further Details:      
 
Domain Number 2 Region: 170-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000687
Family B-box zinc-binding domain 0.0028
Further Details:      
 
Domain Number 3 Region: 36-87
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000353
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|111386
Sequence length 772
Sequence
MESNGEIHKKASRDPTPDTLSNGLALEGEDSSSSSEDKFICGICNGKFKVPKVLHCLHAF
CEACLEKSLEESGRTQLVCHTCKQITRLTMAGGVGELPIDAVIVNMMEMEAICSMQVICT
SCKAQENAVARCSDCSNFLCSNCVTAHNYMRVFDSHKVETFDELKNGKGIHKPMYCIVHP
TEHFKFYCRTCQVLTCAECMLYLHKQPDHHCERIVDIDRDQRAELKAIVTETKSKMSAFE
DTSGKLESLLSDLQQQRDNAHDLIKETFQSFKATLEKRKDDLIKELEDIHSEKELTVMEM
FHNLGKTVDKMEDACKFMERLVEHADAVEMMAVSKIVRAQMALLNDEVPRSDMSVKIEVE
SDPNKFAEATRQFFCAFKRPDSGNNAYQTAVNACGMLDPSSNPLNLPSELLSSLAANLTP
PLLNDLASSIATSLPPNSNLSSLSQTLSFADRSLFYCFTFSNHLSPDLPLNGVFQVPPSS
YPAQGPSSIRARSSGKTNSMEIRTKFGQLGPGKGQFNAPHGFCLGMDEDIVVADTNNHRI
QVFDKSGEFKYQFGIPGLEEGQLWYPRKVAVIRTSGRYVVCDRGSERSRMQLFTRTGQFI
KKIAIRYIDIVAGLAITSQGHIVAVDSVSPTVFCISESGELIKWFDCSDYMREPSDIAVS
GKDYYVCDFKGHCVVVFNEDGQFLHRIGCETITNYPNGIDISDAGDVLIGDSHGNRFHVA
VFQRDGSLIGEFECPYVKVSRCCGLKITSEGYIVTLAKNNQHVLVLNTLYIA
Download sequence
Identical sequences T1EFA8
jgi|Helro1|111386 XP_009016856.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]