SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|115175 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|115175
Domain Number - Region: 84-208
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000565
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number - Region: 396-516
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00706
Family Growth factor receptor domain 0.003
Further Details:      
 
Domain Number - Region: 218-342
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0143
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 579-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0728
Family Laminin-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|115175
Sequence length 795
Sequence
MVHDIEPEKFTNMTNSPQCPVGTFGLRCRLNCDACANGGECNKEMNACECSEGWAGVLCA
SPCPEGFYGKGCNEVCKCKNEGKCDHVTGSCTCPLGVSGEFCRDGCPAGFYGEDCKRRCQ
QCWSGRCHKRHGFCICPPGFFSHNCQLTCPAWSYGSNCLKGCRCVMENSLACDKTNGSCQ
CKPGYRGDMCQDVCEDGTWGEGCAFKCSCASLSSLTSSSCDHVTGQCAAKCPAGWQGENC
DIPCSSGYYGLECREVCACSGSPCDIQTGACHCMPGRIGITCEQDCPPNHWGVGCSKMCE
CENEALCDVISGHCVCPAGYFGRRCEEVCPHGTYGMNCERECECMNGATCNHVTGQCTCP
LAWTGQLCDRPCPPGKHGMNCMHQCTCKNSAECDAVTGKCLCTSGFSGEDCSEKCPQGTY
GQGCQHQCTCTNSATCDHISGTCLCIAGWHGLHCEKKCPEGFYGDECQKVCNCRLGLCHH
VTGDYGYTCYGGWTGSLCKVECPKGYHSSSCQGICDCKNGGFCDSENGKCRCRSGYHGDK
CQYQCPQGFYGRKCDGKCKCVQPDDVNGSSSTISSNNNNNNNNNCHFITGKCFCPAGKTG
PRCQNDCPSGTYGIDCVHKCACENEGVCDVATGACACSAGYTTATCGQRCPHGRFGANCM
NVCICQNNSTCHHVTGQCTCQHGYYGDLCQNVCEENTYGLNCESKCTCGRGKCDHVTGKC
TCPPGYSGDQCIEPCKPGTYGPGCGFQCTCPTNRCHTTTGLFLFGDSINNNINNNGNNGN
ILLFSNSKYQILIMK
Download sequence
Identical sequences T1EG70
XP_009027840.1.102002 jgi|Helro1|115175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]