SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|117052 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|117052
Domain Number 1 Region: 471-668
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.64e-39
Family SPRY domain 0.002
Further Details:      
 
Domain Number 2 Region: 404-499
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000349
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 3 Region: 195-254
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000133
Family B-box zinc-binding domain 0.0025
Further Details:      
 
Domain Number 4 Region: 1-34
Classification Level Classification E-value
Superfamily RING/U-box 0.0000883
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|117052
Domain Number - Region: 133-177
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0795
Family TFIIH p44 subunit cysteine-rich domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|117052
Sequence length 718
Sequence
MEEELKCPNCLRIITNPVLLTTCQHCVCLDCATRLQMPLPMPLVSTPSLLTSKTLNDSGI
IVGGYETGSIFSETDSGVVCSRPDSYIAIGNGATAQVAITCPLCFNVTYSDDKGALSLPR
AKTLLAISTRYRENKQLRVACQICNGSSSSQHLKPASKMCKECETFYCDDCCKIYHTMEK
HELMAADEAREYLLRRECLCSDHAGEQASMYCVPCRVCVCELCRQQNHLQHQLQPLLQAS
KSHKAELSQMLHSLSEKAKSGTEFIARLKGLQEKVEETSSDFEQTVLRQCDQLIEAIKQH
KRKLLSTIQSEKSQKLQTFKNQMVQCSGKVQKTTGLLQFSIEVLKENDPVSFLQISSSLL
NKVSEVDANFVKEVEFEPRETAEFEYRIDSSRVLRAIESLELVQMKAPGVPQILLGECSG
ESNTITIVWQANQIRGGHPDGYNLEIDDGNSGAFRKVFAGKETICTIEGLHFDTPYRARV
KAFNVAGDSGYSQCITLRTSRVAWFTFDACHTSGDVQLTNNNMTASCSSFEDRVVLGSVG
FVRGVHFWEYVVDRYENNKDPAFGVARYDVDKHKMLGKDDKGWSTYLDNNRSWFIHNGQH
VGRTHGGIGVGSVLGVLLDLDQQHLSFFLNGERHGPIMAFTGLTGVFYPAMSINRNVQIT
LNSGLEPPLVNLVSPSNLAPSTNNNNNNSSSGFAMQTAAGCNNFQLRGVDCSDKSIAA
Download sequence
Identical sequences T1EGJ7
XP_009012087.1.102002 jgi|Helro1|117052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]