SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|122015 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|122015
Domain Number 1 Region: 3-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.56e-73
Family Lectin leg-like 0.00000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|122015
Sequence length 459
Sequence
IKRRFEYKLSFKGPHLVLKDGTVPFWDHYGSAIASADSIRITPSLKSKKGSIWGKEKVTA
EDWEVDVKFTVTGRGRLGADGLAVWYTTERGIEGPVFGSKDQWNGLGVFLDSFDNDGQHN
NPYIMAMLNDGKQTYDHDADGSNQQLGGCLRDFRNKNKPVKIKIEYFKKVLTISFHSGMS
DNEEDYDLCTRIENVNLPPNGYFGVSAATGGLADDHDVLSFSTYSLQLQTEVGTKMEMPE
LEKEKIEKEFQEYKEKLEKAREDFKKENPKAKLDLDVDEDKIYESPEVRSLRQIFEGQSE
ISQFIKSSLRKLDEIVGRQERQLSLLTSISQSRQQAGQSSSPGSTIDKKEFNQIVDAQKA
ATEGIKDLRQVVNDINTKFNGLKIPDQHQFTKELANHFGMMLNEFRSLSNKVNDISSNIA
NSPSISVYHLGFFLFIHLLTILGYFIYKAKKEAAAKKFY
Download sequence
Identical sequences T1EGT6
XP_009019335.1.102002 jgi|Helro1|122015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]