SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|122321 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|122321
Domain Number 1 Region: 13-211
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-64
Family Calnexin/calreticulin 0.0000349
Further Details:      
 
Domain Number 2 Region: 195-309
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.96e-44
Family P-domain of calnexin/calreticulin 0.00000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|122321
Sequence length 387
Sequence
VIVKLIATVFTEPTVYFKEEFDDGWRSRWVESTAKGSDQGEFGWSAGKFFNDPEKDKGLK
TTQDAKFYGISAKFDKPFSNEGKTLVVQFSVKHEQEIDCGGGYVKIFPSDLDQKNMHGDS
PYNIMFGPDICGYSTKKVHVIFNYNGKNLLTKKEIRCKDDVLTHLYTLIVRPDNTYEVKI
DNKKEESGTLEEDWDFLEPKKIKDPDAKKPEDWDDRENIDDPDDKKPEDWDKPEHIPDAT
ATKPEDWDDEMDGEWEPPMVDNPEYKGEWKPKQIPNPSYKGSWVHPEIDNPAYVADSKLY
SYSDIGAIGFDLWQVKSGSIFDNILITDDEAYAEKYGEETWGVMKAGEAKAKEKADEIEN
KKHKAKADDDDDDEDENEEDEDEKKTD
Download sequence
Identical sequences T1EGU5
XP_009012062.1.102002 jgi|Helro1|122321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]