SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|124458 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|124458
Domain Number 1 Region: 62-193
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000204
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 188-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000343
Family EGF-type module 0.009
Further Details:      
 
Domain Number 3 Region: 1-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000377
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 4 Region: 36-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000186
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 5 Region: 226-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000372
Family EGF-type module 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|124458
Sequence length 270
Sequence
ECSSNPCRNGGTCTDAVNGYRCTCAPGYTGLYCSDDIDQCLNNPCKNGGTCQSQAGRFTC
SCPGGFIGSTCEIEVNECQSNPCLNGGSCFDRVNSYSCICLPGIVGTNCEINTNECLSNP
CQNAGSCVDGINSYRCNCQPGWIGSNCELDINECSSNPCRNGGQCDNLLNMFSCRCALGF
TGIFCEQNINDCLSNRCMNGATCVDGIGAYSCTCVSGWTGQFCDQDVNECASNPCQYGAS
CSNNFNFFTCTCAPGYRGVTCSEDVDECAT
Download sequence
Identical sequences T1EH15
jgi|Helro1|124458 XP_009020670.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]