SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|124998 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|124998
Domain Number 1 Region: 110-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000015
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 35-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000411
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 79-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000482
Family EGF-type module 0.023
Further Details:      
 
Domain Number 4 Region: 1-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000116
Family EGF-type module 0.036
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|124998
Domain Number - Region: 152-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000911
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|124998
Sequence length 175
Sequence
PCLNDAACQTVPSGFYMCHCKLPYSGKHCQTSKEWCLNDTNPCVNGGECVKTAQNYSCLC
PENTYGLNCEMERQCERLQPCQNGGMCRDSASGYVCKCAGSYAGESCQYIDYCLSNPCLN
AGACLSLDKDFFCQCPKPFRGKNCQIKGKYAFNIPCKNDGECQSFEETFYCTCEP
Download sequence
Identical sequences T1EH40
jgi|Helro1|124998 XP_009010634.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]