SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|126561 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|126561
Domain Number 1 Region: 7-128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-19
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|126561
Sequence length 144
Sequence
FTYRSLDSRSGIFHSPNFPHPYPRNLTCHYKFIGRSNEHIVIVFRHVDVEGVMPNCSSDT
KSDVIELSNYNYPLADSKHSPLCGLKKESSRNFEKKIYKYESDGNFFRVTFKANDAYEAS
GFEASYKFYLKDTSSYTNLKESNN
Download sequence
Identical sequences T1EHA4
XP_009019657.1.102002 jgi|Helro1|126561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]