SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|133373 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|133373
Domain Number 1 Region: 12-53
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000073
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 132-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 58-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000373
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 91-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000646
Family EGF-type module 0.0077
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|133373
Domain Number - Region: 178-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00515
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|133373
Sequence length 198
Sequence
CRVWFLLMFSSDHNPCYKENKCMNGGTCLNKPENQYECACTPDYTGDHCEKKTICDKLSP
CLNGGQCRPLNADSYVCTCPSPFYGKHCEHRDICQDNNPCLNGGQCVANVDGQYKCLCPK
PYIGDKCEILDHNPCYKENKCMNGGTCLNKPENQYECACTPDYTGDHCEKKTICDKLSPC
LNGGQCRPLNADSYVCTC
Download sequence
Identical sequences T1EI04
XP_009015542.1.102002 jgi|Helro1|133373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]