SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|134277 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|134277
Domain Number 1 Region: 74-113
Classification Level Classification E-value
Superfamily vWA-like 0.000000207
Family Integrin A (or I) domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|134277
Sequence length 113
Sequence
VMNAIAWSSHLDEAFMRNAQQHARLKWQYFCGVDGHLRIFPGVQWKAADSSEAVADLFDC
RLQEWYVKAATSAKDVIILLDISGSMKGLNIEIAKTTISRILQTITADDYFNV
Download sequence
Identical sequences T1EI39
jgi|Helro1|134277 XP_009016298.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]