SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|135549 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|135549
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily vWA-like 0.0000000004
Family Integrin A (or I) domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|135549
Sequence length 125
Sequence
PPDCYFNIIGFGSTFELLFNEGSKKYKKESLEKALEHQKTLSADFGGTEILEPLVSVYSK
QILPAHSRNIFLIIDGEVFNTEAVVSLVQKHSHDTRVFTLNTGEGASTTLIKGVASAGKG
KTEFV
Download sequence
Identical sequences T1EI95
jgi|Helro1|135549 XP_009013080.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]