SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|136198 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|136198
Domain Number 1 Region: 56-105
Classification Level Classification E-value
Superfamily vWA-like 0.00000668
Family Integrin A (or I) domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|136198
Sequence length 111
Sequence
IISGATWTSELDGTFTKNFQDDPDLSWQVFASSAGFMRIFPGFRWPSHQEDDVDLYDCRL
QPWYIRAANSPKNAIILIDSSGSMRGLRREIARTTVEKIVETFGVDDFFNV
Download sequence
Identical sequences T1EIC6
jgi|Helro1|136198 XP_009026684.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]