SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|136702 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|136702
Domain Number 1 Region: 1-44
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000054
Family ATI-like 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|136702
Domain Number - Region: 52-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0544
Family Cripto EGF-like domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|136702
Sequence length 94
Sequence
CVPTCSRMDVGPSCSNGASYPGCQCKQGMLPENNKCYLPKDCPCKYRGEDFPADYVVQNE
CNFCKCFYGSWQCTKNECPKTCSVFGLEHVTTFD
Download sequence
Identical sequences T1EIF4
XP_009018873.1.102002 jgi|Helro1|136702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]