SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|136819 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|136819
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily vWA-like 1.44e-34
Family Integrin A (or I) domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|136819
Sequence length 132
Sequence
DCVQSPNLDIVFVVDESGSICDTDPGFVYGRDSTCTNFRNLLTFVSNLVDSFTIGPSNYR
VGMVTFSSSAEVRWRLDRYYTKADLQAAINSIPYTGGNTFTTGGIRLMRTQVFTQSGDRP
DASNLAIIITDG
Download sequence
Identical sequences T1EIG1
jgi|Helro1|136819 XP_009011208.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]