SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|140913 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|140913
Domain Number 1 Region: 7-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000148
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 2 Region: 163-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000629
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 3 Region: 84-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000132
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 4 Region: 45-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000232
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 5 Region: 130-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000127
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 288-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000464
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 244-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000348
Family EGF-type module 0.02
Further Details:      
 
Domain Number 8 Region: 201-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000144
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|140913
Domain Number - Region: 322-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000142
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|140913
Sequence length 359
Sequence
GPNCEIDIDECVSSPCQHNGTCLDRPGNYSCLCVSGTTGRSCDVDIDECLSSPCLNNGSC
VDRLNGYTCNCTNTGYTGDTCQDDINECVSNPCRNMGLCKDLINRFDCKCPPGYLGSTCQ
VDFNDCTPYSPCLNEATSIDYLLHEGYTCQCSPGFNGVNCSLNIDECLSSPCQNGGTCID
DVNSFRCECRHGYRDVLCQEEINECNELAPCQNGAQCFNTQGDYRCECSNDNAFGGKNCD
VALIGCLNSQCRYGSTCVPHLIDESHGYSCVCSPGYRGSNCEVGTVPQCNQRCQNGATCL
DLWDEFLCYCPRTYYGVTCDICNPCISNPCLNAGTCLFNSNLSASNAYTCKCDRGYVCV
Download sequence
Identical sequences T1EJ20
XP_009019975.1.102002 jgi|Helro1|140913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]