SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|143353 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|143353
Domain Number 1 Region: 3-167
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000238
Family Integrin A (or I) domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|143353
Sequence length 171
Sequence
GSASLAFVFDITGSMSVDLAQAIEGAAKILATTLQQKDKPLHNYILVPFQDPEVGPVTIT
RDPEKFQSVLRELYVQGGGDCPEMSLSGIKLALEKALPFSFIYVFTDASAKDYHLTDEVL
SLIQEKQSQVVFILTGDCGNRTEPGYVAYERIAAASSGQIFRLEKAEVNLV
Download sequence
Identical sequences T1EJA1
XP_009028618.1.102002 jgi|Helro1|143353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]