SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|144286 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|144286
Domain Number 1 Region: 83-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000111
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 46-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000165
Family EGF-type module 0.021
Further Details:      
 
Domain Number 3 Region: 121-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000269
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 9-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000231
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|144286
Sequence length 159
Sequence
VIFIIILAKPCSPSKCRNNATCLPKLQVTYSCACLANFIGRNCEYVDPCIKKPCKNGGSC
HAIGLFYRCLCPPGFAGHYCQMVDQCVSNPCQNGGTCTKHRRGYKCQCATGYTGDTCERI
CPCSSNPCENGGTCISKGDSFVCKCPPFFAGFTCTTGQL
Download sequence
Identical sequences T1EJE0
jgi|Helro1|144286 XP_009015298.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]