SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|144641 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|144641
Domain Number 1 Region: 67-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000105
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 2 Region: 29-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000028
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 1-28
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000411
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|144641
Sequence length 103
Sequence
NGGRCVEGVDATRCVCPSGRSGPTCDTTNNRCIMNPCRSGATCTSLPGGYTCGPCPINYS
GFYCERSINECLSNPCHNGGTCSDDYNRFTCSCRTGFTGVLCQ
Download sequence
Identical sequences T1EJF3
XP_009009971.1.102002 jgi|Helro1|144641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]