SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|145161 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|145161
Domain Number 1 Region: 38-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000649
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000521
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 3 Region: 77-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|145161
Sequence length 112
Sequence
ECQNPLCQRNGQCVQSINTYFCFCQSGYAGKNCESNSDNECLSNPCQNQGTCVDLINGYR
CTCSDVSTGSNCERTETNCQNSQCQNGGICMASRKEAICRCYGNFGGAYCDK
Download sequence
Identical sequences T1EJJ0
jgi|Helro1|145161 XP_009028698.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]