SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|149755 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|149755
Domain Number - Region: 66-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00104
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 100-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00283
Family EGF-type module 0.076
Further Details:      
 
Domain Number - Region: 3-31
Classification Level Classification E-value
Superfamily EGF/Laminin 0.013
Family EGF-type module 0.093
Further Details:      
 
Domain Number - Region: 38-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0223
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|149755
Sequence length 130
Sequence
VQSCSGNGLCVAPDVCQCYSGWTGLNCGKYSCSRVYDCLGRGACVGPDRCSCEAGWWGDD
CSRTNCYQRNNCSNRGVCIGPDQCMCASQYSGLDCSQLPVCKSFCSGNGLCVAPDVCQCY
SGWTGLNCGK
Download sequence
Identical sequences T1EKD5
XP_009025406.1.102002 jgi|Helro1|149755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]