SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|151403 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|151403
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily Kelch motif 4.71e-35
Family Kelch motif 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|151403
Sequence length 187
Sequence
IFVAGGYERGNWCSSKAFYSYNPNIQQWVELSMMNEARVSFSLVSTNNGIYAIAGIDHIV
SNNIDREIILHSVEFYNPIDNVWSFSAPLTHGCYNMSAVSNNDHLYMSGGISDDPQHSVP
INNFYTKSIHSGDWRELAPLNVGRHSHVMIFKNENLFVLGGFMESEAAMGFNDCHQTEMY
DLETNQW
Download sequence
Identical sequences T1EKK3
XP_009013560.1.102002 jgi|Helro1|151403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]