SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|152409 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|152409
Domain Number - Region: 7-68
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00536
Family Pentapeptide repeats 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|152409
Sequence length 124
Sequence
HTHIYATTLQHTHIYATTLQHTHAYATTLQHTHIYATTLQHTHAYATTLQHTHIYATTLQ
HTHAYATTVQHTHTFNFVKLIDNITTHLHVQTSQHKISYITHTHARSPSLSHTHTHKHTN
KHTH
Download sequence
Identical sequences T1EKR7
jgi|Helro1|152409 XP_009016647.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]