SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|157218 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|157218
Domain Number 1 Region: 36-337
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.95e-35
Family beta-glycanases 0.026
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|157218
Domain Number - Region: 557-635
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0195
Family Laminin G-like module 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|157218
Sequence length 650
Sequence
MSFQLFAWCMSFFLLLCQNVHGYYNISVSGGYGRSFDGIGAISGGGATSKLLVNYPPKQR
DEILDYLFKPNFAASLHILKVEIGGDAQSTERDGTESSHMHESWDENYERGYEWWLMVEA
KKRNPSIKIACLPWAFPGWVGEGKPDPYNRPNTTAMYVVKWILGAKKYYNIDVDYVGIWN
ERRYTTEYVKVLKQLLLANNLKNVKMVVADGDWSVSADIMKDPAFAAVVDVIGAHYPGTE
STEDSQKTNKTLWASEDYSTFNDDVGAGCWARLLNRNYVKGLMTSTIAWNLVASYYDALP
YTRDGLMTANEPWSGYYEVANPIWVTAHTTQFTKIGWRYLKHESGVGHLERGGTYVTLIS
PDNKDITIIIETMTYNHSKCIRPRIPKYEVFSQQAEFFFSGILSGVTKLNRWKSSFKYGL
GEKSSVFVKMEPIKVSLSSFRLSLEPDEVYTLTTLEVGVKGQYGSPPPSQKFPLPYSDSY
TNYPHYSEAFNFVPQCGVWEVRPAYDDPKNKVNRQVIITKRDVAVSVKMLIPRSNGTTGA
FVGSRIDRGGCEALTAKGVFFTIFPADSSYAVYCRLDRTCKITTGVLKDPLKFDTWYTLK
IDTKNSVSSLYIDNKLLITVSLPGTIPKNGFVGYGTTNFGIADFDDLSVM
Download sequence
Identical sequences T1EM85
jgi|Helro1|157218 XP_009020395.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]