SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|158373 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|158373
Domain Number 1 Region: 71-258
Classification Level Classification E-value
Superfamily vWA-like 2.49e-38
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 2 Region: 376-446
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000945
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 3 Region: 431-494
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 608-663
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000135
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|158373
Domain Number - Region: 274-416,447-458
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00753
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|158373
Sequence length 993
Sequence
MAKIFKFQKISFFYIFFIAINKFSLTAALNKNDDEAIDKRLCNENSQKNFNIRNITKIEF
LGSILKKHVQKLRDTKNWKVELVFLIDASGSVGVKNFNNELKFVKKLLSDFTVDQHTTRV
AVVTFSSKSRVHRHVDYMTRPHEHNHKCALMQHHFPLIQYTGGGTYTLGAMLEAQSVFKF
SRLDAKKTLFLITDGFSNNGNPKPVAEWLKQLGIEIFTIGISKGNVQELCEMASYPRVEH
TYILNSFEEFEALARRALHEDLHSGNYVLQNLKYCQNLCNSVTENCCDTLATCKCGTHTG
RYECVCKAGYYGSGLKGNCFACPQGTYKTFSSPGDVSTCSPCPDVNHISPLASSSVQQCI
CKPGYQLKKSICEAKLCPDLLPPKNGFFVQGNCSKSVNAACGLSCEFGYQLIGSSVRICN
EDGIWSGEESVCQAKRCPSLSPPTNGFMNCSNNNFTIQTECHFHCTPDYSLTGSRSRSCL
ALAKWTGMQAHCNEVHSTTSISKEVHKIRTQRENVHGSVEPNKKHSRNKIGQITELCGIP
EATPCVSDKPFLKITRLVRVKGALRFKSTSRKTFLASIVANSVNCIFSNDVSFNGAASNR
IRTWATTIQCHALPELKNGLTHPKRCTTSESTSGSICYFSCFSGFKLLGPSNKTCLSNGK
WSIADYHSYCKDITPPEMTCPSDQTVRTVLNENVALVSWNHPKPTDNSNISPYLYIIPSV
HSPTYLPIGKHTIQYVAEDMGKNKAQCLFDVTVVDIESPRVDRCVSPPMPFIRKHTPMQI
IWEEPIFSDNSGDAVHIVGPSTPLSFPTGTSNLVYYASDKFNNTSNCTVTITVQDHLCNK
HEPTNGYLECKDSDNYIFCTSNCNHGFKFVNNPAPTYSCNYEEGRWEPNILWPPSDCAKS
LKSKTIQQSTQLNFRGNSICNKSDLFIKLEISVGNVLNSKKINEDALKGDFDFMYEENKL
RLVDMKTRERKAVCPTGSVPLQTDCGWFNYCLK
Download sequence
Identical sequences T1EMQ1
XP_009008708.1.102002 jgi|Helro1|158373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]