SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|158374 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|158374
Domain Number 1 Region: 392-504
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.31e-16
Family Laminin G-like module 0.053
Further Details:      
 
Domain Number 2 Region: 198-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000058
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 3 Region: 261-387
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 139-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|158374
Domain Number - Region: 17-171
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0604
Family Growth factor receptor domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|158374
Sequence length 623
Sequence
MFFNVTSETCETCPISQCLPGSFSFDGLEPCWTCDVSSYQHMYAQVECFQCAANLTTLKR
GSRSSSDCKGQCEEGYISKSGLEPCLACPKGYYQPGKGGSLCMACPSNTTTTEVGATSCS
QQFEALQASTNHNENDLVMNDCFSMPCLNGGSCAVMFLSYQCTCLLGWTDDMVLTLTNRF
GFDKVVENLLKGMNCEIEVNECLSEPCLNGGTCSDQLNGYSCNCLPGFAGASCERDVDEC
ASMPCLHNSTCLDFVNRFHCICQPDYTGSFCETVVDDCLSITCFNGGTCVDEIAGYTCIC
DEGYLGVHCEVEINECRSNPCLRGATCVDLVAGFSCKCEDGYGGLLCADDLDECLSNPCL
NNATCIDHEAHYKCNCQPSYGGTNCENKLSSNFDLTFSFASVTNYAFVENALRSGVVEKL
SVAFWMKNGDTDSQGTPFSYSTKDHENAFTLTDYNGFVLYINGQSKVTDVTCNDGRWHHI
AILWSGRDWAIYKDAIKVDSGQMKVKKTEKLRKLTMGQWVTVFGWVNVSLVRTFDSLTHQ
QKGEERLNIPNKTDDNMQLEDLILNTVVAKEGRSNSESLPFENTTHVTDVSEQPSKKAKS
SFAWFQIQNIGVNKAKSETKSVF
Download sequence
Identical sequences T1EMQ2
jgi|Helro1|158374 XP_009008709.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]