SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|158375 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|158375
Domain Number 1 Region: 1602-1671
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000459
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 124-191
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1655-1716
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 301-367
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 987-1048
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000375
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 9-87
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000136
Family Pentraxin (pentaxin) 0.0037
Further Details:      
 
Domain Number 7 Region: 182-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000025
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 8 Region: 1486-1554
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000121
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 9 Region: 413-481
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000032
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 10 Region: 239-312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000375
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 11 Region: 945-995
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000959
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 12 Region: 358-421
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000195
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 13 Region: 754-808
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000306
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 14 Region: 692-742
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000431
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 15 Region: 599-667
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000473
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 16 Region: 802-864
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000025
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 17 Region: 476-542
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000306
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 18 Region: 1544-1607
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000653
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 19 Region: 540-604
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000542
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 20 Region: 855-917
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000153
Family Complement control module/SCR domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|158375
Sequence length 1723
Sequence
MNSNVSKIHVGDGVLVVGQEQDEVGGGFSILETFVGSLSRFNIWSRMLEDKEISDLYNKC
DEFTGNVLAWPDLIHSLVGNVQVDPSVLCSGRDGSNSKFDQRSNSRIVYSLDTQYQKIPI
LKTTCLEPNPITNGNIIWTSISYNSYIQYSCSSGYNMKGTSRRQCHASNEWSSTEPSCEK
LQCLTLPAVYNATWTFSENYFESVANFSCDYGFKIIGNNHVVCEDDGVWRGSLGYCQEIT
CNMPELSDKLIYIHNESISILNVDSVMVFDCISGYNLIGSNVLKCTDKSLWDNEVPYCQP
VKCIEPPILNYGFITNQSLEYYYGDVVHYNCIQNYIFRGETFITCLEDGLWDEKMQECIP
ITCPPIYVENAIQSSPDVLAVGAKIEIACIDGYDPIGGMELYCLGNGTWSEIIPLCTLGS
CSELNVQLVPHLKIVNVNELTFGVGSKVHFSCEDDYVIKGASSIYCGKNKTWSHDMPVCE
NIHCIVPTLTSSELLVNYSQPKILRGSMIEFKCKPGYRISGRDSLSCLGNDLFDGHLPLC
HQITCRKPEIDYGFILSDELFLEDNKTYHVECNENYFLNGTSTIKCLDNKVSPQPLPKCL
PVLCEAISISNGMLISKNKSNIFSPGSKLEFKCINHYKLIGSHEAICDQFGNWRYAIFPS
CVEVECPSLASNIGLITLIYNFSTSHFSQISQEVKFVIGSKIKFECDIDYILRGVDVIEC
TADGTWSHASPICELQIFCIPPEDDYFTIEILKGEQTIDSKYPESSQISYQCPTGYYLLG
ETKNLCTASGTWLHDHPSCKEIQCPLLNITEAQLDSLNTSFGTIVNIKCNTGFQPSGTIQ
LECLKSGFWSDAPATCMKKFCDKPNISYSNFTNLSDSVSKFSLDKIEVKCFNDYKLVGPS
HIFCVDLEWKPSLPSCLPKTCQLPTIFNDTNIIINQSNSEMFQQITDFTVAINSKLTFSC
HQNYKLSGRSYVLCLSNESWSHDFPSCEEIVCEPPVIENGFIASNASTNVGAILLFKCNE
GFVISGEDVLQCMQDGIWNFSFPVCVFQMYADENSGIGNSTTQEINNLYLNKSDEITECF
EHFECNYRPYLNIFKEENVECRFGPNGEFCGLKHVAWHVNEIWNKGMTSCRNGSNLNFSR
IAGIFVNEVNFVSEECTCMFDNTEIINVLPLIAVFNVEPFCNSSNNSSLSLYQLINFIAF
QNKDSLNVSQVLHYGGLETFIEMTNHYKKLLQVEYDSTKCQDDEIYVGEKMRHEKTSAEK
KFHLSSLKLQCCEDQKTNETMGPFCLGGCGWNNFQPLHSFIFFPTTENDLKCHSSNSSDI
CTYLLYSLNEGYSSLDLQKIGCKFNSFFQNDNLNFVCNFKSIFSFQKQCIDEIEKCTEEH
SNNKTSHIDRISITNLLYVSNGRLVLDEAPHIPMLCMNNKLFSVCSFLLVASNFDNNKNS
CLPSYKSPPCNLTSCNSSDECCWISVGSKNLSGTFKNLSGTFKNLSCGLPTPILFGKVNF
NSTSCKKLAQYACGAGYSMDGKNYSVCLENQKWSNYSGVCKKIKCENPPTPIHAYLLQKD
LTAGEHSYMKCDTGYLPMGNNTLACSLDGKWILNDSFWCREIKCNSPQSIFHGQFVVHNF
SLNGHVEYSCEEDYILIGNEKRTCLINSSWNGFEPRCLLKECVPLNKISNGGMNSTSFTV
NSTVGYWCNEGYELEGNLHRICRRDGSWTGSQPICRGFISKII
Download sequence
Identical sequences T1EMQ3
XP_009008710.1.102002 jgi|Helro1|158375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]