SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|158962 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|158962
Domain Number 1 Region: 29-178
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 8.5e-30
Family Integrin alpha N-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 342-477
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-20
Family Integrin domains 0.0047
Further Details:      
 
Domain Number 3 Region: 178-341
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000194
Family Integrin domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|158962
Sequence length 555
Sequence
MKKHLKNVCDVLATTSASCVGIDCSDTLDRYEDLVVGAPFYYEKGYSGAVYVYYNGPGQE
GLSDSPQKLKGTKSSNFVDVRFGFAIACGGDLNQDGFDDLVVGAPFEDSGAIYIFHGSTS
LLSLSQKVTVRDFVPISSMKLFGYAISKKFVDTDDNGYLDFLVGSYQSDSVVLLRTRPVV
NIHFSAETSPKIIDPKNPLCTNSTNPKDRCFAVSFKYKYTWILENKRSNKDKLNVLLTAS
IDNALASRAKFHTEGYNKSWKLAVDTFDTNLSTYVYLTENNRDWLSPITLTYTYELVLPE
THNRNGNDFGPMGSLEKHPVLNAKNPKTGLVEVHFLKECGDDDKCDSDLNLKLESPSFNK
ISGLFEFKFSEELKLDVVVTNHGEDAHQAFLYVNLTKGLTFRGKDATAASEMISCEYIEH
ASLLQCGVGNPLASHDVVHLRIRLSAKNLQTSLTHLNIEAFVNTTSNFDPSKTMANITFE
KITESDLALIRLKMLEMCHFQVRMFSFPGRIYYWVTNSCFTSLTNLKCLNGFAQDYSIKK
YESTILPLENNKTTI
Download sequence
Identical sequences T1ENF8
jgi|Helro1|158962 XP_009009150.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]