SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|158989 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|158989
Domain Number 1 Region: 64-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000241
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 164-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000101
Family I set domains 0.028
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|158989
Domain Number - Region: 6-60
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00753
Family V set domains (antibody variable domain-like) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|158989
Sequence length 231
Sequence
MQDSSLHSSEWIKINAELPDNVIIEPDRLIIAHLEKGSGGRYKCMSVDGEGTHITKFFNL
VNLYEPKAEIYPKWLKRTVGASASFKCFGAYTPDFTIAWSRSNGQNLDVNGDTLTLNDIT
TEDEDSYECIIENEFGQSRATAQLFVVNLHDDEGERIAEYKQIELHNELQLACPAAQNVE
WTKVESDLPHHAFIEDGKLLISRVDEEDGGMYRCRSQDDMLTKYFDVTVIC
Download sequence
Identical sequences T1ENG4
jgi|Helro1|158989 XP_009009175.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]