SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|159578 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|159578
Domain Number 1 Region: 314-527
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000000000615
Family SGL-like 0.036
Further Details:      
 
Domain Number 2 Region: 7-97
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000843
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|159578
Sequence length 605
Sequence
MNNKEIQETCKMIICTLCGATIRDPVTNANCFDVFCKFCIEDYFEKFTSYQSSLKSSKNV
GANVTCPVCGKVFHHLSLVTGFHKDNPVLKFIQKKSMDGLLTDKVRIKNYVVESTDKLTR
SESALKDIILRINYLHDQKVKDLDFMKQKINGIVNEAIQNIKNAGSKLFSQIDNIKSIFM
HSINAIKQYCELVQSSASKLLTSLMINYTDSVNEVFAGLNVEKILKRASEISKQPELISI
PPTVMAKYSFEYSSASAGSLGELRQLPDPYVLPEKLFHENNLSKEKSSSKLSPVSNSVAM
GVRRKWSTCLRDASHHSSKPSGVCFFNSNQNVAVTEMAKGTLLSLSTTDGKVVETIINKQ
NFYPLGLTRLETSGEFATIDKNSRTVSEVRNKFLKPVKTIFNLPQALGYYNEMFFVTDSH
RKSLTCLNRNGRINWLIGNREENFFSSPNYLSVCHKHHRIFVSDENCLKIFDTKGNHVKS
VSDPKWQLKGSCVDSCGNVIVVEDSRNRLMKFDQNGEYVNDLPASLNFRSARWVLRSALN
FASDGEIVREVGREFQRKGPEKAKADLAKECLTRVKKKREKEDDRKPGRLGSINISDKYL
GNNLD
Download sequence
Identical sequences T1EP66
XP_009009704.1.102002 jgi|Helro1|159578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]