SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|159670 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|159670
Domain Number 1 Region: 17-127
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000809
Family Laminin G-like module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|159670
Sequence length 129
Sequence
MCIAIVKNHKHNTVISTDNVISILSSSSPTHQFQAIISSSSIFIFTTRAFKTTYDVCNNK
YHTINMMINSAGVTLSVDSIYQESKQFDSTFAYAAPLSVPIYLGGVKDPLWNIPGVFSST
SMLGCIQRS
Download sequence
Identical sequences T1EPA6
jgi|Helro1|159670 XP_009009791.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]